The domain within your query sequence starts at position 15 and ends at position 90; the E-value for the LAMTOR domain shown below is 1.1e-26.

DREERKLLLDPSSTPTKALNGAEPNYHSLPSARTDEQALLSSILAKTASNIIDVSAADSQ
GMEQHEYMDRARQYST

LAMTOR

Late endosomal/lysosomal adaptor and MAPK and MTOR activator
LAMTOR
SMART accession number:SM01262
Description: LAMTOR is a family of eukaryotic proteins that have otherwise been referred to as Lipid raft adaptor protein p18, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1, and Protein associated with DRMs and endosomes. It is found to be one of three small proteins constituting the Rag complex or Ragulator that interact with each other, localise to endosomes and lysosomes, and play positive roles in the MAPK pathway. The complex does this by interacting with the Rag GTPases, recruiting them to lysosomes, and bringing about mTORC1 activation.
Interpro abstract (IPR028209):

LAMTOR1 is a family of eukaryotic proteins that have otherwise been referred to as Lipid raft adaptor protein p18, Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1, and Protein associated with DRMs and endosomes.

LAMTOR1 regulates the mTOR (mammalian target of rapamycin) pathway, a signaling cascade that promotes cell growth in response to growth factors, energy levels, and amino acids. LAMTOR1 is part of the Ragulator complex, recruits the Rag GTPases and the mTORC1 complex to lysosomes, a key step in activation of the TOR signaling cascade by amino acids [ (PUBMED:19654316) ]. LAMTOR1 is responsible for anchoring the Ragulator complex to membranes. It may regulate both the recycling of receptors through endosomes and the MAPK signaling pathway through recruitment of some of its components to late endosomes [ (PUBMED:20381137) ]. It may be involved in cholesterol homeostasis regulating LDL uptake and cholesterol release from late endosomes/lysosomes. It may also play a role in RHOA activation [ (PUBMED:20544018) (PUBMED:19177150) ].

This family also includes Saccharomyces cerevisiae MEH1 (Ego1), a component of the EGO complex. The EGO complex and the Rag-Ragulator complex are structurally related [ (PUBMED:22424774) ]. The yeast EGO complex consists of Gtr1, Gtr2, Ego1, and Ego3, localises to the endosomal and vacuolar membranes, and plays a crucial role in cell growth and autophagy regulation through amino acid signals that activate TORC1 [ (PUBMED:15989961) ]. MEH1 (GSE2) is also a component of the GSE complex, which is required for proper sorting of amino acid permease Gap1 [ (PUBMED:16732272) ].

GO process:positive regulation of TOR signaling (GO:0032008), positive regulation of MAPK cascade (GO:0043410), endosomal transport (GO:0016197), cholesterol homeostasis (GO:0042632), regulation of receptor recycling (GO:0001919), lysosome organization (GO:0007040), cellular response to amino acid stimulus (GO:0071230)
GO component:late endosome membrane (GO:0031902), membrane raft (GO:0045121), Ragulator complex (GO:0071986)
Family alignment:
View or

There are 801 LAMTOR domains in 799 proteins in SMART's nrdb database.

Click on the following links for more information.