The domain within your query sequence starts at position 341 and ends at position 465; the E-value for the LH2 domain shown below is 2.65e-27.

FHYQVKIHFSGTEDGKQHNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIG
ELLMMKLKWISDSYFSWPDWWSSPSFVIERIRVKAGETQKKVIFCAREKVSHLQKGKDSA
VFVKC

LH2

Lipoxygenase homology 2 (beta barrel) domain
LH2
SMART accession number:SM00308
Description: -
Interpro abstract (IPR001024):

This entry represents a domain found in a variety of membrane or lipid associated proteins. It is known as the PLAT (Polycystin-1, Lipoxygenase, Alpha-Toxin) domain or LH2 (Lipoxygenase homology) domain, is found in a variety of membrane or lipid associated proteins. Structurally, this domain forms a beta-sandwich composed of two sheets of four strands each [ (PUBMED:10469604) (PUBMED:11985859) (PUBMED:11412104) ]. The most highly conserved regions coincide with the beta-strands, with most of the highly conserved residues being buried within the protein. An exception to this is a surface lysine or arginine that occurs on the surface of the fifth beta-strand of the eukaryotic domains. In pancreatic lipase, the lysine in this position forms a salt bridge with the procolipase protein. The conservation of a charged surface residue may indicate the location of a conserved ligand-binding site. It is thought that this domain may mediate membrane attachment via other protein binding partners.

GO function:protein binding (GO:0005515)
Family alignment:
View or

There are 13940 LH2 domains in 7296 proteins in SMART's nrdb database.

Click on the following links for more information.