The domain within your query sequence starts at position 201 and ends at position 253; the E-value for the LRRCT domain shown below is 2.04e-7.

NPWVCDCRLYDLVHLLDGWVSSNLIFIEARLRCASPRSLAGVAFSQLELRKCQ

LRRCT

Leucine rich repeat C-terminal domain

• SMART accession number: SM00082
• Description: -
• Interpro abstract (IPR000483):

  Leucine-rich repeats (LRR, see IPR001611 ) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [ (PUBMED:14747988) ]. LRRs occur in proteins ranging from viruses to eukaryotes, and appear to provide a structural framework for the formation of protein-protein interactions [ (PUBMED:11751054) ]. Proteins containing LRRs include tyrosine kinase receptors, cell-adhesion molecules, virulence factors, and extracellular matrix-binding glycoproteins, and are involved in a variety of biological processes, including signal transduction, cell adhesion, DNA repair, recombination, transcription, RNA processing, disease resistance, apoptosis, and the immune response.

  LRRs are often flanked by cysteine-rich domains: an N-terminal LRR domain ( IPR000372 ) and a C-terminal LRR domain. This entry represents the C-terminal LRR domain.

There are 43815 LRRCT domains in 36442 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Kobe B, Deisenhofer J
• A structural basis of the interactions between leucine-rich repeats and protein ligands.
• Nature. 1995; 374: 183-6

The leucine-rich repeat is a recently characterized structural motif used in molecular recognition processes as diverse as signal transduction, cell adhesion, cell development, DNA repair and RNA processing. We present here the crystal structure at 2.5 A resolution of the complex between ribonuclease A and ribonuclease inhibitor, a protein built entirely of leucine-rich repeats. The unusual non-globular structure of ribonuclease inhibitor, its solvent-exposed parallel beta-sheet and the conformational flexibility of the structure are used in the interaction; they appear to be the principal reasons for the effectiveness of leucine-rich repeats as protein-binding motifs. The structure can serve as a model for the interactions of other proteins containing leucine-rich repeats with their ligands.

• Kobe B, Deisenhofer J
• The leucine-rich repeat: a versatile binding motif.
• Trends Biochem Sci. 1994; 19: 415-21

Leucine-rich repeats are short sequence motifs present in a number of proteins with diverse functions and cellular locations. All proteins containing these repeats are thought to be involved in protein-protein interactions. The crystal structure of ribonuclease inhibitor protein has revealed that leucine-rich repeats correspond to beta-alpha structural units. These units are arranged so that they form a parallel beta-sheet with one surface exposed to solvent, so that the protein acquires an unusual, nonglobular shape. These two features may be responsible for the protein-binding functions of proteins containing leucine-rich repeats.

Disease (disease genes where sequence variants are found in this domain)

SwissProt sequences and OMIM curated human diseases associated with missense mutations within the LRRCT domain.

Protein	Disease
Platelet glycoprotein Ib alpha chain (P07359) (SMART)	OMIM:231200: Bernard-Soulier syndrome

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
36.42	map04620	Toll-like receptor signaling pathway
16.18	map04512	ECM-receptor interaction
13.29	map04360	Axon guidance
12.14	map04640	Hematopoietic cell lineage
6.94	map04010	MAPK signaling pathway
4.05	map04510	Focal adhesion
2.89	map05216	Thyroid cancer
2.89	map04210	Apoptosis
1.73	map00680	Methane metabolism
1.73	map00940	Phenylpropanoid biosynthesis
1.73	map00360	Phenylalanine metabolism

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with LRRCT domain which could be assigned to a KEGG orthologous group, and not all proteins containing LRRCT domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of LRRCT domains in PDB

PDB code	Title
1gwb	structure of glycoprotein 1b
1m0z	Crystal Structure of the von Willebrand Factor Binding Domain of Glycoprotein Ib alpha
1m10	Crystal structure of the complex of Glycoprotein Ib alpha and the von Willebrand Factor A1 Domain
1ook	Crystal Structure of the Complex of Platelet Receptor GPIb-alpha and Human alpha-Thrombin
1ozn	1.5A Crystal Structure of the Nogo Receptor Ligand Binding Domain Reveals a Convergent Recognition Scaffold Mediating Inhibition of Myelination
1p8t	Crystal structure of Nogo-66 Receptor
1p8v	CRYSTAL STRUCTURE OF THE COMPLEX OF PLATELET RECEPTOR GPIB-ALPHA AND ALPHA-THROMBIN AT 2.6A
1p9a	Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha at 1.7 Angstrom Resolution
1qyy	Crystal Structure of N-Terminal Domain of Human Platelet Receptor Glycoprotein Ib-alpha at 2.8 Angstrom Resolution
1sq0	Crystal Structure of the Complex of the Wild-type Von Willebrand Factor A1 domain and Glycoprotein Ib alpha at 2.6 Angstrom Resolution
1u0n	The ternary von Willebrand Factor A1-glycoprotein Ibalpha-botrocetin complex
1w8a	Third LRR domain of Drosophila Slit
1ziw	Human Toll-like Receptor 3 extracellular domain structure
2a0z	The molecular structure of toll-like receptor 3 ligand binding domain
2id5	Crystal Structure of the Lingo-1 Ectodomain
2ifg	Structure of the extracellular segment of human TRKA in complex with nerve growth factor
2o6q	Structural diversity of the hagfish Variable Lymphocyte Receptors A29
2o6r	Structural diversity of the hagfish Variable Lymphocyte Receptors B61
2o6s	Structural diversity of the hagfish Variable Lymphocyte Receptors B59
2r9u	Crystal Structure of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain
2v70	Third LRR domain of human Slit2
2v9s	Second LRR domain of human Slit2
2v9t	Complex between the second LRR domain of Slit2 and The first Ig domain from Robo1
2wfh	The Human Slit 2 Dimerization Domain D4
2xot	Crystal structure of neuronal leucine rich repeat protein AMIGO-1
2z62	Crystal structure of the TV3 hybrid of human TLR4 and hagfish VLRB.61
2z63	Crystal structure of the TV8 hybrid of human TLR4 and hagfish VLRB.61
2z64	Crystal structure of mouse TLR4 and mouse MD-2 complex
2z65	Crystal structure of the human TLR4 TV3 hybrid-MD-2-Eritoran complex
2z66	Crystal structure of the VT3 hybrid of human TLR4 and hagfish VLRB.61
2z7x	Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide
2z80	Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide
2z81	Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide
2z82	Crystal structure of the TLR1-TLR2 heterodimer induced by binding of a tri-acylated lipopeptide
3a79	Crystal structure of TLR2-TLR6-Pam2CSK4 complex
3a7b	Crystal structure of TLR2-Streptococcus Pneumoniae lipoteichoic acid complex
3a7c	Crystal structure of TLR2-PE-DTPA complex
3b2d	Crystal structure of human RP105/MD-1 complex
3cig	Crystal structure of mouse TLR3 ectodomain
3ciy	Mouse Toll-like receptor 3 ectodomain complexed with double-stranded RNA
3e6j	Crystal Structure of Variable Lymphocyte Receptor (VLR) RBC36 in Complex with H-trisaccharide
3fxi	Crystal structure of the human TLR4-human MD-2-E.coli LPS Ra complex
3g39	Structure of a lamprey variable lymphocyte receptor
3g3a	Structure of a lamprey variable lymphocyte receptor in complex with a protein antigen
3j0a	Homology model of human Toll-like receptor 5 fitted into an electron microscopy single particle reconstruction
3kj4	Structure of rat Nogo receptor bound to 1D9 antagonist antibody
3p72	structure of platelet Glycoprotein 1b alpha with a bound peptide inhibitor
3pmh	Mechanism of Sulfotyrosine-Mediated Glycoprotein Ib Interaction with Two Distinct alpha-Thrombin Sites
3rez	glycoprotein GPIb variant
3rfe	Crystal structure of glycoprotein GPIb ectodomain
3rfj	Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
3rfs	Design of a binding scaffold based on variable lymphocyte receptors of jawless vertebrates by module engineering
3rg1	Crystal structure of the RP105/MD-1 complex
3t6q	Crystal structure of mouse RP105/MD-1 complex
3ul7	Crystal structure of the TV3 mutant F63W
3ul8	Crystal structure of the TV3 mutant V134L
3ul9	structure of the TV3 mutant M41E
3ula	Crystal structure of the TV3 mutant F63W-MD-2-Eritoran complex
3ulu	Structure of quaternary complex of human TLR3ecd with three Fabs (Form1)
3ulv	Structure of quaternary complex of human TLR3ecd with three Fabs (Form2)
3v44	Crystal structure of the N-terminal fragment of zebrafish TLR5
3v47	Crystal structure of the N-tetminal fragment of zebrafish TLR5 in complex with Salmonella flagellin
3vq1	Crystal structure of mouse TLR4/MD-2/lipid IVa complex
3vq2	Crystal structure of mouse TLR4/MD-2/LPS complex
3w3g	Crystal structure of human TLR8 (unliganded form)
3w3j	Crystal structure of human TLR8 in complex with CL097
3w3k	Crystal structure of human TLR8 in complex with CL075
3w3l	Crystal structure of human TLR8 in complex with Resiquimod (R848) crystal form 1
3w3m	Crystal structure of human TLR8 in complex with Resiquimod (R848) crystal form 2
3w3n	Crystal structure of human TLR8 in complex with Resiquimod (R848) crystal form 3
3wn4	Crystal structure of human TLR8 in complex with DS-877
3zyi	NetrinG2 in complex with NGL2
3zyj	NetrinG1 in complex with NGL1
3zyn	Crystal structure of the N-terminal leucine rich repeats of Netrin-G Ligand-3
3zyo	Crystal structure of the N-terminal leucine rich repeats and immunoglobulin domain of netrin-G ligand-3
4arn	Crystal structure of the N-terminal domain of Drosophila Toll receptor
4arr	Crystal structure of the N-terminal domain of Drosophila Toll receptor with the magic triangle I3C
4bv4	Structure and allostery in Toll-Spatzle recognition
4c2a	Crystal Structure of High-Affinity von Willebrand Factor A1 domain with R1306Q and I1309V Mutations in Complex with High Affinity GPIb alpha
4c2b	Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation in Complex with High Affinity GPIb alpha
4cnc	Crystal structure of human 5T4 (Wnt-activated inhibitory factor 1, Trophoblast glycoprotein)
4cnm	Crystal structure of human 5T4 (Wnt-activated inhibitory factor 1, Trophoblast glycoprotein)
4g8a	Crystal structure of human TLR4 polymorphic variant D299G and T399I in complex with MD-2 and LPS
4j4l	Modular evolution and design of the protein binding interface
4lxr	Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and innate immunity
4lxs	Structure of the Toll - Spatzle complex, a molecular hub in Drosophila development and innate immunity (glycosylated form)
4oqt	LINGO-1/Li81 Fab complex
4p8s	Crystal structure of Nogo-receptor-2
4p91	Crystal structure of the nogo-receptor-2 (27-330)
4pbv	4PBV
4pbw	4PBW
4q3g	4Q3G
4q3i	4Q3I
4qbz	4QBZ
4qc0	4QC0
4qdh	4QDH
4qxe	4QXE
4qxf	4QXF
4r07	4R07
4r08	4R08
4r09	4R09
4r0a	4R0A
4r6a	4R6A
4rca	4RCA
4rcw	4RCW
4u7l	4U7L
4uip	4UIP
4v2c	4V2C
4v2d	4V2D
4v2e	4V2E
4xsq	4XSQ
4y61	4Y61
4yeb	4YEB
5awa	5AWA
5awb	5AWB
5awc	5AWC
5awd	5AWD
5az5	5AZ5
5cmn	5CMN
5cmp	5CMP
5d3i	5D3I
5ftt	5FTT
5ftu	5FTU
5gmf	5GMF
5gmg	5GMG
5gmh	5GMH
5gs0	5GS0
5gs2	5GS2
5hdh	5HDH
5ijb	5IJB
5ijc	5IJC
5ijd	5IJD

Links (links to other resources describing this domain)

• INTERPRO: IPR000483