The domain within your query sequence starts at position 1 and ends at position 80; the E-value for the LSM14 domain shown below is 9.12e-20.

MAMDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDIT
ELKILEIPGPGDNQQVGDLH

LSM14

Scd6-like Sm domain
LSM14
SMART accession number:SM01271
Description: The Scd6-like Sm domain is found in Scd6p from S. cerevisiae, Rap55 from the newt Pleurodeles walt, and its orthologs from fungi, animals, plants and apicomplexans PMID:15257761. The domain is also found in Dcp3p and the human EDC3/FLJ21128 protein where it is fused to the the Rossmanoid YjeF-N domain PMID: 15257761,15225602. In addition both EDC3 and Scd6p are found fused to the FDF domain PMID: 15257761,15225602.
Interpro abstract (IPR025609):

The Lsm14 N-terminal domain is a type of LSM domain found in Lsm14 proteins (also known as Rap55) [ (PUBMED:17074753) (PUBMED:18723115) ] and in the Saccharomyces cerevisiae homologue Scd6 [ (PUBMED:15225602) ]. The domain is also found in the human EDC3 protein (enhancer of mRNA-decapping protein 3) where it is fused to the the Rossmanoid YjeF-N domain [ (PUBMED:15257761) ]. In addition, both EDC3 and Scd6 are found fused to the FDF domain [ (PUBMED:15225602) (PUBMED:15257761) ].

Family alignment:
View or

There are 3439 LSM14 domains in 3428 proteins in SMART's nrdb database.

Click on the following links for more information.