The domain within your query sequence starts at position 505 and ends at position 618; the E-value for the MA3 domain shown below is 4.76e-35.

LLKLTEAVVTDYLNSGNANDAVSGVREMRAPKHFLPEMLSKVIILSLDRSDEDKEKASSL
ISLLKQEGIATSDNFMQAFLNVLEQCPKLEVDIPLVKSYLAQFAARAIISELVS

MA3

Domain in DAP-5, eIF4G, MA-3 and other proteins.
MA3
SMART accession number:SM00544
Description: Highly alpha-helical. May contain repeats and/or regions similar to MIF4G domains Ponting (TIBS) "Novel eIF4G domain homologues" in press
Interpro abstract (IPR003891):

This entry represents the MI domain (after MA-3 and eIF4G), it is a protein-protein interaction module of ~130 amino acids [ (PUBMED:10958635) (PUBMED:10973054) (PUBMED:15082783) ]. It appears in several translation factors and is found in:

  • One copy in plant and animal eIF4G 1 and 2 (DAP-5/NAT1/p97)
  • Two copies in the animal programmed cell death protein 4 (PDCD4) or MA-3 that is induced during programmed cell death and inhibits neoplastic transformation
  • Four tandem-repeated copies in a group of uncharacterised plant proteins

The MI domain consists of seven alpha-helices, which pack into a globular form. The packing arrangement consists of repeating pairs of antiparallel helices packed one upon the other such that a superhelical axis is generated perpendicular to the alpha-helical axes [ (PUBMED:17060447) ].

The MI domain has also been named MA3 domain.

Family alignment:
View or

There are 8427 MA3 domains in 6622 proteins in SMART's nrdb database.

Click on the following links for more information.