The domain within your query sequence starts at position 8 and ends at position 87; the E-value for the MAGE_N domain shown below is 4.74e0.

HYCSLQGSARSQRELDNVQATIAVVDEEEATPTSKKVYSSGIPSPPQSPQRASSPLVILA
SVPEGPSEEASTNQVEEQED

MAGE_N

Melanoma associated antigen family N terminal
MAGE_N
SMART accession number:SM01392
Description: This domain family is found in eukaryotes, and is typically between 82 and 96 amino acids in length. This family is the N terminal of various melanoma associated antigens. These are tumor rejection antigens which are expressed on HLA-A1 of tumor cells and they are recognized by cytotoxic T lymphocytes (CTLs).
Interpro abstract (IPR021072):

This domain is found N-terminal in various melanoma associated antigens from eukaryotes, and is typically between 82 and 96 amino acids in length. These are tumour rejection antigens which are expressed on HLA-A1 of tumour cells and they are recognised by cytotoxic T lymphocytes (CTLs) [ (PUBMED:7642112) ].

Family alignment:
View or

There are 2336 MAGE_N domains in 2261 proteins in SMART's nrdb database.

Click on the following links for more information.