The domain within your query sequence starts at position 204 and ends at position 305; the E-value for the MBT domain shown below is 2.88e-49.
SSWPMFLLRVLTGSELAPAVFFKEEPPRPLQNNFIVGMKIEAVDRKNPFMICPATIGAVC GDQLHITFDGWSGAFDYWCDYDSRDIFPVGWCRLTGDVLQPP
MBTPresent in Drosophila Scm, l(3)mbt, and vertebrate SCML2 |
---|
SMART accession number: | SM00561 |
---|---|
Description: | Present in Drosophila Scm, l(3)mbt, and vertebrate SCML2. These proteins are involved in transcriptional regulation. |
Interpro abstract (IPR004092): | The function of the malignant brain tumor (MBT) repeat is unknown, but is found in a number of nuclear proteins involved in transcriptional repression. The repeat contains a completely conserved glutamate at its amino terminus that may be important for function. The crystal structure of the two MBT repeats of human SCM-like 2 protein has been reported. Each repeat consists of an extended "arm" and a globular core. The arm of the first repeat packs against the core of the second repeat and vice versa. The structure of the core-interacting part of each arm consists of an N-terminal alpha-helix and a turn of 3 10 helix connected by a short beta-strand. The core consists of an Src homology 3-like five-stranded beta-barrel followed by a C-terminal alpha-helix and another short beta-strand. Each arm interacts with its partner core in a similar way, with the orientation of the N-terminal helix relative to the barrel varying slightly. There are also extensive interactions between the two barrels [ (PUBMED:12952983) ]. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO component: | nucleus (GO:0005634) |
Family alignment: |
There are 15038 MBT domains in 5088 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)