SMART: Mab-21 domain annotation

The domain within your query sequence starts at position 194 and ends at position 528; the E-value for the Mab-21 domain shown below is 4.37e-84.

SMYENWQVERPLRCHLFIPFIPPEPYSFHPEFWCSSLSTPLERQGYGQIKVTLADGNPLG
CVCGKAKLEEDMLCLLYGKNRGAWPSSAGCGEMEGLLCSRESSYLDVMQVMKWFQMALTR
AWHRIAHKYEFDLAFGELDTPGSLKIKFRSGKSMPFILTPVIQCNDSDLYFILQLPKEPC
GGGPASSAHWLLSFAVYEREFLRMTGKALPEGACHLSCLQIASFLLSKQTRLTGPSGLSD
YHLKTALLHLLLSRQASDWKASKLDVRLQDLFCFLERSLLEKKLYHFFMGNHKVPEALGL
PEVVRRAEPLNLFRPFVLQRTLYRNTVDSFYEMLK

Mab-21

SMART accession number:	SM01265
Description:	This family contains Mab-21 and Mab-21 like proteins. In C. elegans these proteins are required for several aspects of embryonic development (PUBMED:8582275); (PUBMED:15385160).
Interpro abstract (IPR024810):	This domain is present in Mab-21 and Mab-21 like proteins. In Caenorhabditis elegans these proteins are required for several aspects of embryonic development [ (PUBMED:8582275) (PUBMED:15385160) ]. This entry also includes inositol 1,4,5-triphosphate receptor-interacting proteins, which are predicted to contain a partial Mab-21 domain [ (PUBMED:16990268) ].
Family alignment:	View or

There are 5197 Mab-21 domains in 5185 proteins in SMART's nrdb database.

Click on the following links for more information.

Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing Mab-21 domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with Mab-21 domain is also avaliable.

Click on the protein counts, or double click on taxonomic names to display all proteins containing Mab-21 domain in the selected taxonomic class.
Structure (3D structures containing this domain)

Links (links to other resources describing this domain)
INTERPRO IPR024810
PFAM Mab-21

PDB code	Main view	Title
4jlx		Structure of porcine cyclic GMP-AMP synthase (cGAS)
4jlz		Structure of porcine cGAS in complex with bound UTP
4k8v		Structure of cyclic GMP-AMP Synthase (cGAS)
4k96		Structure of Binary Complex of cGAS with Bound dsDNA
4k97		Structure of Ternary Complex of cGAS with dsDNA and Bound ATP
4k98		Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppG(2 ,5 )pG
4k99		Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pppdG(2 ,5 )pdG
4k9a		Structure of Ternary Complex of cGAS with dsDNA and Bound 5 -pG(2 ,5 )pA
4k9b		Structure of Ternary Complex of cGAS with dsDNA and Bound c[G(2 ,5 )pA(3 ,5 )p]
4kb6		Structure of porcine cyclic GMP AMP synthase (CGAS) in complex with DNA, ATP and GTP
4km5		X-ray crystal structure of human cyclic GMP-AMP synthase (cGAS)
4lev		Structure of human cGAS
4lew		Structure of human cGAS
4ley		Structure of mouse cGAS bound to 18 bp DNA
4lez		Structure of mouse cGAS bound to an 18bp DNA and cGAS product
4mkp		Crystal structure of human cGAS apo form
4nxt		Crystal structure of the cytosolic domain of human MiD51
4nxu		Crystal structure of the cytosolic domain of human MiD51
4nxv		Crystal structure of the cytosolic domain of human MiD51
4nxw		Crystal structure of the cytosolic domain of human MiD51
4nxx		Crystal structure of the cytosolic domain of human MiD51
4o67		Human cyclic GMP-AMP synthase (cGAS) in complex with GAMP
4o68		Structure of human cyclic GMP-AMP synthase (cGAS)
4o69		Human cyclic GMP-AMP synthase (cGAS) in complex with sulfate ion
4o6a		Mouse cyclic GMP-AMP synthase (cGAS) in complex with DNA
4oaf		Crystal structure of the cytosolic domain of mouse MiD51
4oag		Crystal structure of the cytosolic domain of mouse MiD51 bound to ADP
4oah		Crystal structure of the cytosolic domain of mouse MiD51 H201A mutant
4oai		Crystal structure of the cytosolic domain of mouse MiD51 dimer mutant
4woy		4WOY
5eog		5EOG
5eom		5EOM

INTERPRO	IPR024810
PFAM	Mab-21

The domain within your query sequence starts at position 194 and ends at position 528; the E-value for the Mab-21 domain shown below is 4.37e-84.

Mab-21

Taxonomic distribution of proteins containing Mab-21 domain.

3D Structures of Mab-21 domains in PDB