The domain within your query sequence starts at position 61 and ends at position 347; the E-value for the Mab-21 domain shown below is 3.59e-94.
NRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITAS GYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIW PRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGKQSSAESDAWVLQFAEAENR LQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRL NGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAR
Mab-21 |
---|
SMART accession number: | SM01265 |
---|---|
Description: | This family contains Mab-21 and Mab-21 like proteins. In C. elegans these proteins are required for several aspects of embryonic development (PUBMED:8582275); (PUBMED:15385160). |
Interpro abstract (IPR024810): | This domain is present in Mab-21 and Mab-21 like proteins. In Caenorhabditis elegans these proteins are required for several aspects of embryonic development [ (PUBMED:8582275) (PUBMED:15385160) ]. This entry also includes inositol 1,4,5-triphosphate receptor-interacting proteins, which are predicted to contain a partial Mab-21 domain [ (PUBMED:16990268) ]. |
Family alignment: |
There are 5197 Mab-21 domains in 5185 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)