The domain within your query sequence starts at position 49 and ends at position 173; the E-value for the Mad3_BUB1_I domain shown below is 1.83e-68.

LQQQKRAFESEIRFYSGDDPLDVWDRYINWTEQNYPQGGKESNMSALVERAIEALQGETR
YYNDPRFLSLWIKLGHLCNEPLDMYSYLQSQGIGVSLAQFYISWAEEYEARENFKKADII
FQEGI

Mad3_BUB1_I

Mad3/BUB1 hoMad3/BUB1 homology region 1
Mad3_BUB1_I
SMART accession number:SM00777
Description: Proteins containing this domain are checkpoint proteins involved in cell division. This region has been shown to be essential for the binding of the binding of BUB1 and MAD3 to CDC20p.
Interpro abstract (IPR013212):

Proteins containing this domain are checkpoint proteins involved in cell division. This region has been shown to be essential for the binding of Bub1 and Mad3 to Cdc20 [ (PUBMED:10704439) ].

Family alignment:
View or

There are 2311 Mad3_BUB1_I domains in 2307 proteins in SMART's nrdb database.

Click on the following links for more information.