The domain within your query sequence starts at position 272 and ends at position 303; the E-value for the Mterf domain shown below is 2.12e-1.

RDLVVRLPRLLTGSLEPVKENMKVYHLELGFK

Mterf

Mitochondrial termination factor repeats
Mterf
SMART accession number:SM00733
Description: Human mitochondrial termination factor is a DNA-binding protein that acts as a transcription termination factor. Six repeats occur in human mTERF, that also are present in numerous plant proteins.
Interpro abstract (IPR003690):

This entry represents the mitochondrial/chloroplastic transcription termination factors (MTERFs). In humans four MTERFs have been identified (MTERF1-4). MTERF1 was first identified as a factor responsible for terminating heavy strand transcription at a specific site at the leu-tRNA, thereby modulating the ratio of mitochondrial ribosomal RNA to mRNA [ (PUBMED:2752429) ]. Later, MTERF1 was found to stimulate transcriptional initiation [ (PUBMED:19366610) ] and appeared to be in the control of mitochondrial replication pausing [ (PUBMED:17884915) ]. From a structural study, it binds to dsDNA containing the termination sequence and unwinds the DNA molecule, promoting base eversion, which is critical for transcription termination [ (PUBMED:20550934) ].

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:double-stranded DNA binding (GO:0003690)
Family alignment:
View or

There are 39944 Mterf domains in 7121 proteins in SMART's nrdb database.

Click on the following links for more information.