The domain within your query sequence starts at position 1428 and ends at position 1567; the E-value for the N-SET domain shown below is 6.75e-64.

SEFEQMTILYDIWNSGLDLEDMSYLRLTYERLLQQTSGADWLNDTHWVQHTITNLSTPKR
KRRPQDGPREHQTGSARSEGYYPISKKEKDKYLDVCPVSARQLEGGDTQGTNRVLSERRS
EQRRLLSAIGTSAIMDSDLL

N-SET

COMPASS (Complex proteins associated with Set1p) component N
N-SET
SMART accession number:SM01291
Description: The n-SET or N-SET domain is a component of the COMPASS complex, associated with SET1, conserved in yeasts and in other eukaryotes up to humans. The COMPASS complex functions to methylate the fourth lysine of Histone 3 and for the silencing of genes close to the telomeres of chromosomes PMID:11805083. This domain promotes trimethylation in conjunction with an RRM domain PMID:15775977and is necessary for binding of the Spp1 component of COMPASS into the complex PMID:16921172.
Interpro abstract (IPR024657):

The COMPASS complex (complex proteins associated with Set1p) is conserved in yeasts and in other eukaryotes up to humans. The COMPASS complex functions to methylate the fourth lysine of Histone 3 and for the silencing of genes close to the telomeres of chromosomes [ (PUBMED:11805083) ].

Five domains are conserved in Saccharomyces cerevisiae Set1 and other eukaryotic Set1-related proteins: an amino-terminal RNA-recognition motif (RRM), a semi-conserved central domain, an N-SET domain, the catalytic SET domain, and the C-terminal post-SET domain. This entry represents the N-SET domain, which promotes trimethylation in conjunction with the RRM domain [ (PUBMED:15775977) ] and is necessary for binding of the Spp1 component of COMPASS into the complex [ (PUBMED:16921172) ].

Family alignment:
View or

There are 1652 N-SET domains in 1648 proteins in SMART's nrdb database.

Click on the following links for more information.