The domain within your query sequence starts at position 27 and ends at position 71; the E-value for the NPP domain shown below is 1.55e-22.

WCLESSQCQDLTTESNLLACIRACKLDLSLETPVFPGNGDEQPLT

NPP

Pro-opiomelanocortin, N-terminal region
NPP
SMART accession number:SM01364
Description: This family features the N-terminal peptide of pro-opiomelanocortin (NPP). It is thought to represent an important pituitary peptide, given its high yield from pituitary glands, and exhibits a potent in vitro aldosterone-stimulating activity (PMID:6945581).
Interpro abstract (IPR013593):

This domain represents the N-terminal peptide of pro-opiomelanocortin (NPP). It is thought to represent an important pituitary peptide, given its high yield from pituitary glands, and exhibits a potent in vitro aldosterone-stimulating activity [ (PUBMED:6945581) ].

Family alignment:
View or

There are 276 NPP domains in 275 proteins in SMART's nrdb database.

Click on the following links for more information.