The domain within your query sequence starts at position 27 and ends at position 71; the E-value for the NPP domain shown below is 1.55e-22.
WCLESSQCQDLTTESNLLACIRACKLDLSLETPVFPGNGDEQPLT
NPP
Pro-opiomelanocortin, N-terminal region
SMART accession number:
SM01364
Description:
This family features the N-terminal peptide of pro-opiomelanocortin (NPP). It is thought to represent an important pituitary peptide, given its high yield from pituitary glands, and exhibits a potent in vitro aldosterone-stimulating activity (PMID:6945581).
This domain represents the N-terminal peptide of pro-opiomelanocortin (NPP). It is thought to represent an important pituitary peptide, given its high yield from pituitary glands, and exhibits a potent in vitro aldosterone-stimulating activity [ (PUBMED:6945581) ].
Family alignment:
There are 276 NPP domains in 275 proteins in SMART's nrdb database.
Click on the following links for more information.
Evolution (species in which this domain is found)
Taxonomic distribution of proteins containing NPP domain.
This tree includes only several representative species. The complete taxonomic breakdown of all proteins with NPP domain is also avaliable.
Click on the protein counts, or double click on taxonomic names to display all proteins containing NPP domain in the selected taxonomic class.
Literature (relevant references for this domain)
Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.
Complete amino acid sequence of a human pituitary glycopeptide: an importantmaturation product of pro-opiomelanocortin.
Proc Natl Acad Sci U S A. 1981; 78: 4236-40
Display abstract
A glycopeptide isolated in relatively large amounts from human pituitary glandswas completely purified, and its sequence was determined. The primary sequencerepresents the NH2-terminal 76 amino acid residues of pro-opiomelanocortin(POMC). This important secretory product of POMC was shown to possess aninteresting aldosterone-stimulating activity on a human adrenal aldosteronoma. Itis O-glycosylated at Thr-45 and N-glycosylated at Asn-65. Only one sequencevariation with the human genomic DNA was found. Furthermore, comparison with the other preferred cleavage sites of human POMC reveals that the pair of basicresidues Lys-Arg represents the major sites of enzymatic maturation of thisprecursor molecule. This predicts a highly specific type of enzyme involved inthe maturation of POMC in the anterior lobe of the human pituitary.
Links (links to other resources describing this domain)