The domain within your query sequence starts at position 24 and ends at position 145; the E-value for the NRF domain shown below is 3.58e-13.
SLKCMQDTDEFLSDLNSLKPKEYALRMYDSVGKLGSNVLTGNVDRLGSYSECLSTRSPKG SFRGQYCKLHILQDGTDYSVGVCVPDSCAEEDVTMMSQLGTLKFRNTSFLEPSLSLFTKD SS
NRFN-terminal domain in C. elegans NRF-6 (Nose Resistant to Fluoxetine-4) and NDG-4 (resistant to nordihydroguaiaretic acid-4). |
---|
SMART accession number: | SM00703 |
---|---|
Description: | Also present in several other worm and fly proteins. |
Interpro abstract (IPR006621): | This is the N-terminal domain of Caenorhabditis elegans NRF-6 (Nose Resistant to Fluoxetine-4) and NDG-4 (resistant to nordihydroguaiaretic acid-4) proteins; the domain is also present in several other worm and fly proteins. NRF-6 and NDG-4 are multipass transmembrane proteins which may act together in a complex to function to transport fluoxetine across the hypodermal barrier to the inside of the animal, where it can then act on neuromuscular targets to induce muscle contraction.The complex may more generally play a role in regulation of membrane transport in C. elegans [ (PUBMED:10488330) ]. |
Family alignment: |
There are 3235 NRF domains in 3202 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Literature (relevant references for this domain)
- Links (links to other resources describing this domain)