The domain within your query sequence starts at position 299 and ends at position 543; the E-value for the OLF domain shown below is 1.97e-35.
SMITSIGNPAQVLKVRETFGTWMRESANKSDDRIWVTEHFSGIMVKEFKDLPALLNSSFT LLHLPHYFHGCGHAVYNNSLYYHKGGSNTIVRFEFGKETPQTLKLENALYFDRKYLFANS KTYFNIAVDEKGIWIIYASSVDGSSILVAQLDERTFSVTQHINTTYPKSKAGNAFIARGI LYVTDTKDTRVTFAFDLLGGKQINANFDFRMSQSVLAMLSYNMRDQHLYSWEDGHLMLYP VQFLS
OLFOlfactomedin-like domains |
---|
SMART accession number: | SM00284 |
---|---|
Description: | - |
Interpro abstract (IPR003112): | The olfactomedin-like or OLF domain is a module of ~260 residues present in metazoan secreted glycoproteins with a characteristic tissue-specific expression. The domain is named after bullfrog olfactomedin, an extracellular matrix protein of olfactory neuroepithelium, whereof it forms the C-terminal part. Other proteins of the olfactomedin family contain the OLF domain in the C-terminal part, while the N terminus is more variable. Proteins of the latrophilin subfamily have an OLF domain in the N-terminal extracellular part, C-terminal to a SUEL-type lectin domain, and their C-terminal part contains domains of the G-protein coupled receptors family 2. Some OLF domain proteins are involved in the formation of the extracellular matrix, e.g. bullfrog olfactomedin, sea urchin amassin and C. elegans unc-122. In addition, OLF domain proteins can function in developmental processes, e.g. noelin and tiarin [ (PUBMED:12019210) (PUBMED:11867215) (PUBMED:12615070) (PUBMED:15280020) ]. Secondary structure predictions show that the OLF domain contains several beta-strands [ (PUBMED:11867215) (PUBMED:12615070) (PUBMED:15280020) ]. A disulfide bond between two conserved cysteines within the OLF domain of human myocilin is implicated in mutations associated with severe forms of primary open angle glaucoma [ (PUBMED:12615070) ]. |
Family alignment: |
There are 6142 OLF domains in 6140 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Disease (disease genes where sequence variants are found in this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)