The domain within your query sequence starts at position 129 and ends at position 276; the E-value for the PA14 domain shown below is 6.07e-7.

DWCGGAVGHLRRNLHFPLFPHTRTTVTKLAVSPKWKNYGLRIFGFIHPARDGDIQFSVAS
DDNSEFWLSLDESPAAAQLVAFVGKTGSEWTAPGEFTKFSSQVSKPRRLMASRRYYFELL
HKQDDKGSDHVEVGWRAFLPGLKFEIID

PA14

PA14
SMART accession number:SM00758
Description: domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
Interpro abstract (IPR011658):

The PA14 domain forms an insert in bacterial beta-glucosidases, other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins and bacterial toxins, including anthrax protective antigen (PA). The domain also occurs in a Dictyostelium pre-spore cell-inducing factor Psi and in fibrocystin, the mammalian protein whose mutation leads to polycystic kidney and hepatic disease. The crystal structure of PA shows that this domain (named PA14 after its location in the PA20 pro-peptide) has a beta-barrel structure. The PA14 domain sequence suggests a binding function, rather than a catalytic role. The PA14 domain distribution is compatible with carbohydrate binding [ (PUBMED:15236739) ].

Family alignment:
View or

There are 10451 PA14 domains in 9320 proteins in SMART's nrdb database.

Click on the following links for more information.