SMART: PDB domain 1io0

The domain within your query sequence starts at position 296 and ends at position 467; the E-value for the 1io0 domain shown below is 5e-35.

KPSDGQARAEEEAAPSIFDEPLEKVKNNDPEMTEVNVNNSDCITNEILVRFTEALEFNTV
VKVFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLTEL
RFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMD

The domain within your query sequence starts at position 296 and ends at position 467; the E-value for the 1io0 domain shown below is 5e-35.

This is a PDB domain - please see the PDBSUM entry of 1io0 for further annotation