SMART: PDB domain 1ngn

The domain within your query sequence starts at position 400 and ends at position 554; the E-value for the 1ngn domain shown below is 1e-111.

ALSPPRRKSFKKWTPPRSPFNLVQEILFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKY
PSAEVARAADWRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSY
RIFCVNEWKQVHPEDHKLNKYHDWLWENHEKLSLS

The domain within your query sequence starts at position 400 and ends at position 554; the E-value for the 1ngn domain shown below is 1e-111.

This is a PDB domain - please see the PDBSUM entry of 1ngn for further annotation