The domain within your query sequence starts at position 229 and ends at position 347; the E-value for the PEHE domain shown below is 2.73e-41.

VAIPSWRDHSVEPLRDPNPSDILENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQ
RLQLRMYKKKGIQESEPEVTSFFPEPDDVESLLITPFLPVVAFGRPLPKLAPQNFELPW

PEHE

PEHE
SMART accession number:SM01300
Description: This domain was first identified in drosophila MSL1 (male-specific lethal 1) PMID:12698291. In drosophila it binds to the histone acetyltransferase males-absent on the first protein (MOF) and to protein male-specific lethal-3 (MSL3) PMID:15141166;PMID:21217699.
Interpro abstract (IPR029332):

This domain was first identified in drosophila MSL1 (male-specific lethal 1) [ (PUBMED:12698291) ]. In drosophila it binds to the histone acetyltransferase males-absent on the first protein (MOF) and to protein male-specific lethal-3 (MSL3) [ (PUBMED:15141166) (PUBMED:21217699) ]. This domain can also be found in KAT8 regulatory NSL complex subunit 1 (KANSL1 or NSL1), which is involved in acetylation of nucleosomal histone H4 on several lysine residues and therefore may be involved in the regulation of transcription [ (PUBMED:20018852) ].

Family alignment:
View or

There are 1820 PEHE domains in 1820 proteins in SMART's nrdb database.

Click on the following links for more information.