The domain within your query sequence starts at position 309 and ends at position 412; the E-value for the PI3K_C2 domain shown below is 1.87e-28.

KKPSSVSLWSLEQPFSIELIEGRKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVNVCSE
PVWKQRLEFDISVCDLPRMARLCFALYAVVEKAKKARSTKKKSK

PI3K_C2

Phosphoinositide 3-kinase, region postulated to contain C2 domain
PI3K_C2
SMART accession number:SM00142
Description: Outlier of C2 family.
Interpro abstract (IPR002420):

Phosphatidylinositol 3-kinases (PI3Ks) are lipid kinases that phosphorylate 4,5-bisphonate (PI(4,5) P2 or PIP2) at the 3-position of the inositol ring, and thus generate phosphatidylinositol 3,4,5-trisphosphate (PIP3), which, in turns, initiates a vast array of signaling events. PI3Ks can be grouped into three classes based on their domain organisation. Class I PI3Ks are heterodimers consisting of a p110 catalytic subunit and a regulatory subunit of either the p85 type (associated with the class IA p110 isoforms p110alpha, p110beta or p110delta) or the p101 type (associated with the class IB p110 isoform p110gamma). Common to all catalytic subunits are an N-terminal adaptor-binding domain (ABD) that binds to p85, a Ras- binding domain (RBD), a putative membrane-binding domain (C2), a helical domain of unknown function, and a kinase catalytic domain. Class II PI3Ks lack the ABD domain and are distinguished by a carboxy terminal C2 domain. Class III enzymes lack the ABD and RBD domains [ (PUBMED:17626883) (PUBMED:18079394) (PUBMED:20081827) (PUBMED:10580505) ].

The PI3K C2 domain is an eight-stranded antiparallel beta-sandwich consisting of two four-stranded beta-sheets [ (PUBMED:17626883) (PUBMED:18079394) (PUBMED:20081827) (PUBMED:10580505) ].

Family alignment:
View or

There are 4758 PI3K_C2 domains in 4756 proteins in SMART's nrdb database.

Click on the following links for more information.