The domain within your query sequence starts at position 49 and ends at position 249; the E-value for the PIG-X domain shown below is 3.24e-19.
LKDGFHRDLLIKVKFGESIEDLQTCRLLIKHYIPPGLFVDPYELASLRERNLTEAVMLSE SFNIEAPNYLSNESAVLIYARQDAQCIDCFQAFLPVHYRYHRPHKKDGDTLIVVNNPDLL MYCDQEFPILKCWAQSEVAAPCALKSEEICQWKSMQYKSILKNLTVQVPVGLTIHTSLVC SVTLLITILCSTLILLAVFKY
PIG-XPIG-X / PBN1 |
---|
SMART accession number: | SM00780 |
---|---|
Description: | Mammalian PIG-X and yeast PBN1 are essential components of glycosylphosphatidylinositol-mannosyltransferase I. These enzymes are involved in the transfer of sugar molecules. |
Interpro abstract (IPR013233): | Mammalian PIG-X and yeast PBN1 are essential components of glycosylphosphatidylinositol-mannosyltransferase I [ (PUBMED:15635094) ]. These enzymes are involved in the transfer of sugar molecules. They probably act by stabilizing the mannosyltransferase PIG-M (GPI14 in yeast) [ (PUBMED:15635094) (PUBMED:16418276) ]. |
GO process: | GPI anchor biosynthetic process (GO:0006506) |
GO component: | endoplasmic reticulum membrane (GO:0005789) |
Family alignment: |
There are 1054 PIG-X domains in 1054 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Links (links to other resources describing this domain)