The domain within your query sequence starts at position 1878 and ends at position 2059; the E-value for the PKS_KR domain shown below is 2.33e-42.
KSYIITGGLGGFGLELARWLVLRGAQRLVLTSRSGIRTGYQAKHIREWRRQGIQVLVSTS NVSSLEGARALIAEATKLGPVGGVFNLAMVLRDAMLENQTPELFQDVNKPKYNGTLNLDR ATREACPELDYFVAFSSVSCGRGNAGQTNYGFANSTMERICEQRRHDGLPGLAVQWGAIG DV
PKS_KR |
---|
SMART accession number: | SM00822 |
---|---|
Description: | This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain. It uses NADPH to reduce the keto group to a hydroxy group. |
Family alignment: |
There are 38684 PKS_KR domains in 29018 proteins in SMART's nrdb database.
Click on the following links for more information.
- Evolution (species in which this domain is found)
- Cellular role (predicted cellular role)
- Metabolism (metabolic pathways involving proteins which contain this domain)
- Structure (3D structures containing this domain)
- Links (links to other resources describing this domain)