The domain within your query sequence starts at position 515 and ends at position 567; the E-value for the PSI domain shown below is 1.77e-13.

RCTALGRACAECCLARDPYCAWDGSACTRFQPTAKRRFRRQDIRNGDPSTLCS

PSI

domain found in Plexins, Semaphorins and Integrins
PSI
SMART accession number:SM00423
Description: -
Interpro abstract (IPR016201):

This domain is found in several different extracellular receptors, including plexins, which are involved in the development of neural and epithelial tissues [ (PUBMED:17855350) ]; in semaphorins, which regulate axon guidance, immune function and angiogenesis [ (PUBMED:12958590) ]; in integrins, which are important Metazoan adhesion receptors that transmit conformational change bidirectionally across the membrane (integrin alpha and beta subunits form a head and two long legs in the ectodomain and span the membrane) [ (PUBMED:15378069) ]; and in hepatocyte growth factor receptor, which plays important roles in normal development and in tumour growth and metastasis [ (PUBMED:15167892) ].

Family alignment:
View or

There are 31672 PSI domains in 20788 proteins in SMART's nrdb database.

Click on the following links for more information.