The domain within your query sequence starts at position 9 and ends at position 66; the E-value for the PWWP domain shown below is 2.51e-19.

YKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHETAFLGPKDLFPYK

PWWP

domain with conserved PWWP motif

• SMART accession number: SM00293
• Description: conservation of Pro-Trp-Trp-Pro residues
• Interpro abstract (IPR000313):

  The PWWP domain is an around 70 amino acids domain that was named after its central core 'Pro-Trp-Trp-Pro'. The PWWP domain is found in one or, less frequently, in two copies in nuclear, often DNA-binding proteins that function as transcription factors regulating developmental processes. Due to its position, the composition of amino acids close to the PWWP motif and the pattern of other domains present, it has been proposed that the PWWP domain is involved in protein-protein interactions [ (PUBMED:10802047) (PUBMED:28645917) ]. The structure of the PWWP domain comprises a five-stranded beta-barrel followed by a five-helix bundle [ (PUBMED:11836534) ].

  Conservation of the PWWP domain is concentrated on one major and two minor blocks with length differences occurring in between [ (PUBMED:10802047) ].

There are 7446 PWWP domains in 6224 proteins in SMART's nrdb database.

Literature (relevant references for this domain)

Primary literature is listed below; Automatically-derived, secondary literature is also avaliable.

• Stec I et al.
• WHSC1, a 90 kb SET domain-containing gene, expressed in early development and homologous to a Drosophila dysmorphy gene maps in the Wolf-Hirschhorn syndrome critical region and is fused to IgH in t(4;14) multiple myeloma.
• Hum Mol Genet. 1998; 7: 1071-82

Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4 (4p16.3). The smallest region of overlap between WHS patients, the WHS critical region, has been confined to 165 kb, of which the complete sequence is known. We have identified and studied a 90 kb gene, designated as WHSC1 , mapping to the 165 kb WHS critical region. This 25 exon gene is expressed ubiquitously in early development and undergoes complex alternative splicing and differential polyadenylation. It encodes a 136 kDa protein containing four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain also found in the Drosophila dysmorphy gene ash -encoded protein, and a PHD-type zinc finger. It is expressed preferentially in rapidly growing embryonic tissues, in a pattern corresponding to affected organs in WHS patients. The nature of the protein motifs, the expression pattern and its mapping to the critical region led us to propose WHSC1 as a good candidate gene to be responsible for many of the phenotypic features of WHS. Finally, as a serendipitous finding, of the t(4;14) (p16.3;q32.3) translocations recently described in multiple myelomas, at least three breakpoints merge the IgH and WHSC1 genes, potentially causing fusion proteins replacing WHSC1 exons 1-4 by the IgH 5'-VDJ moiety.

Metabolism (metabolic pathways involving proteins which contain this domain)

% proteins involved	KEGG pathway ID	Description
54.55	map00271	Methionine metabolism
27.27	map05210	Colorectal cancer
13.64	map00310	Lysine degradation
4.55	map00280	Valine, leucine and isoleucine degradation

This information is based on mapping of SMART genomic protein database to KEGG orthologous groups. Percentage points are related to the number of proteins with PWWP domain which could be assigned to a KEGG orthologous group, and not all proteins containing PWWP domain. Please note that proteins can be included in multiple pathways, ie. the numbers above will not always add up to 100%.

Structure (3D structures containing this domain)

3D Structures of PWWP domains in PDB

PDB code	Title
1h3z	Solution structure of a PWWP domain from Schizosaccharomyces Pombe
1khc	Crystal Structure of the PWWP Domain of Mammalian DNA Methyltransferase Dnmt3b
1n27	Solution structure of the PWWP domain of mouse Hepatoma-derived growth factor, related protein 3
1ri0	NMR structure of the N-terminal hath domain of human HDGF
2b8a	High Resolution Structure of the HDGF PWWP Domain
2daq	Solution structure of second PWWP domain of WHSC1L1 protein
2gfu	NMR solution structure of the PWWP domain of Mismatch repair protein hMSH6
2l89	Solution structure of Pdp1 PWWP domain reveals its unique binding sites for methylated H4K20 and DNA
2m16	P75/LEDGF PWWP Domain
2nlu	Domain-Swapped Dimer of the PWWP Module of Human Hepatoma-derived Growth Factor
2x35	Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.
2x4w	Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.
2x4x	Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.
2x4y	Molecular basis of Histone H3K36me3 recognition by the PWWP domain of BRPF1.
3eae	PWWP domain of human hepatoma-derived growth factor 2 (HDGF2)
3flg	The PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 beta
3l42	PWWP domain of human bromodomain and PHD finger containing protein 1
3llr	Crystal structure of the PWWP domain of Human DNA (cytosine-5-)-methyltransferase 3 alpha
3lyi	PWWP Domain of Human Bromodomain-Containing Protein 1
3mo8	PWWP Domain of Human Bromodomain and PHD finger-containing protein 1 In Complex with Trimethylated H3K36 Peptide
3pfs	PWWP Domain of Human Bromodomain and PHD finger-containing protein 3
3pmi	PWWP Domain of Human Mutated Melanoma-Associated Antigen 1
3qby	Crystal structure of the PWWP domain of human Hepatoma-derived growth factor 2
3qj6	The crystal structure of PWWP domain of human Hepatoma-derived growth factor 2 in complex with H3K79me3 peptide
3qkj	The PWWP domain of human DNA (CYTOSINE-5-)-METHYLTRANSFERASE 3 BETA in complex with a bis-tris molecule
3zeh	Solution structure of the Hs. PSIP1 PWWP domain
4cos	Crystal structure of the PHD-Bromo-PWWP cassette of human PRKCBP1
4fu6	Crystal structure of the PSIP1 PWWP domain
4ld6	PWWP domain of human PWWP Domain-Containing Protein 2B
4n4g	Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha
4n4h	Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.1K36me3
4n4i	Crystal structure of the Bromo-PWWP of the mouse zinc finger MYND-type containing 11 isoform alpha in complex with histone H3.3K36me3
4ns5	Crystal structure of human BS69 Bromo-Zinc finger-PWWP
4rxj	4RXJ
4z02	4Z02
5b73	5B73
5c6s	5C6S
5ciu	5CIU

Links (links to other resources describing this domain)

• PFAM: PWWP
• INTERPRO: IPR000313