SMART: Pfam domain 2OG-FeII_Oxy

The domain within your query sequence starts at position 47 and ends at position 232; the E-value for the 2OG-FeII_Oxy_2 domain shown below is 5.4e-32.

YTVLFGKAEADKIFRELEQEVEYFTGALAKVQVFGKWHSVPRKQATYGDAGLTYTFSGLT
LTPKPWVPVLERVRDRVCEVTGQTFNFVLVNRYKDGCDHIGEHRDDERELAPGSPIASVS
FGACRDFIFRHKDSRGKRPRRTVEVVRLQLAHGSLLMMNPPTNTHWYHSLPIRKRVLAPR
VNLTFR

2OG-FeII_Oxy_2

PFAM accession number:	PF13532
Interpro abstract (IPR027450):	AlkB is a DNA repair enzyme that removes methyl adducts and some larger alkylation lesions from endocyclic positions on purine and pyrimidine bases. It is a dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron [ (PUBMED:12226668) (PUBMED:21068844) ]. The catalytic core of AlkB is homologous to other Fe-2OG dioxygenases [ (PUBMED:16513174) ]. Two discrete global conformations have been observed for AlkB, differing in accessibility of a putative oxygen-diffusion tunnel [ (PUBMED:19706517) ].

PFAM accession number:

PF13532

Interpro abstract (IPR027450):

AlkB is a DNA repair enzyme that removes methyl adducts and some larger alkylation lesions from endocyclic positions on purine and pyrimidine bases. It is a dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron [ (PUBMED:12226668) (PUBMED:21068844) ]. The catalytic core of AlkB is homologous to other Fe-2OG dioxygenases [ (PUBMED:16513174) ]. Two discrete global conformations have been observed for AlkB, differing in accessibility of a putative oxygen-diffusion tunnel [ (PUBMED:19706517) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2OG-FeII_Oxy_2