The domain within your query sequence starts at position 63 and ends at position 145; the E-value for the 2OG-FeII_Oxy_2 domain shown below is 3.8e-12.
YDHWDAFCGSTIAGLSLLSPSVMKLVHTQEPEQWLELLLEPGSLYILRGSARYDFSHEIL RDEESFFGEHRVPRGRRISVICR
2OG-FeII_Oxy_2 |
![]() |
---|
PFAM accession number: | PF13532 |
---|---|
Interpro abstract (IPR027450): | AlkB is a DNA repair enzyme that removes methyl adducts and some larger alkylation lesions from endocyclic positions on purine and pyrimidine bases. It is a dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron [ (PUBMED:12226668) (PUBMED:21068844) ]. The catalytic core of AlkB is homologous to other Fe-2OG dioxygenases [ (PUBMED:16513174) ]. Two discrete global conformations have been observed for AlkB, differing in accessibility of a putative oxygen-diffusion tunnel [ (PUBMED:19706517) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 2OG-FeII_Oxy_2