The domain within your query sequence starts at position 212 and ends at position 259; the E-value for the 40S_S4_C domain shown below is 1e-32.

DANGNGFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAK

40S_S4_C

• PFAM accession number: PF16121
• Interpro abstract (IPR032277):

  This domain is found at the C terminus of 40S ribosomal protein S4.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 40S_S4_C