The domain within your query sequence starts at position 298 and ends at position 466; the E-value for the 5-nucleotidase domain shown below is 4.8e-62.
EYQLTNENVILTPGPAFRFVKALQHVNSRLRDLYPDEQDLFDIVLMTNNHAQVGVRLINS VNHYGLLIDRFCLTGGKSPIGYLKAYLTNLYLSADSEKVQEAIKEGIASATMYAGAKDMA YCDTQLRVAFDGDAVLFSDESEHIAKDHGLDKFFQHETLFENKPLAQPQ
5-nucleotidase |
![]() |
---|
PFAM accession number: | PF06189 |
---|---|
Interpro abstract (IPR010394): | This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences ( EC 3.1.3.5 ), including cytosolic 5'-nucleotidase 1A and 1B (NT5C1A/NT5C1B) from mammals. NT5C1A/NT5C1B dephosphorylate the 5' and 2'(3')-phosphates of deoxyribonucleotides and help to regulate adenosine levels [ (PUBMED:11133996) ]. |
GO process: | nucleotide metabolic process (GO:0009117) |
GO component: | cytoplasm (GO:0005737) |
GO function: | nucleotide binding (GO:0000166), magnesium ion binding (GO:0000287), 5'-nucleotidase activity (GO:0008253) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 5-nucleotidase