The domain within your query sequence starts at position 3 and ends at position 159; the E-value for the 6PF2K domain shown below is 1.3e-69.
FRKACGPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQY SSYNFFRPDNEEAMRVRKQCALAALRDVKSYLTKEGGQIAVFDATNTTRERRHMILNFAK ENDFKAFFIESVCDDPTVVASNIMQKTFQGDSPGCSL
6PF2K |
![]() |
---|
PFAM accession number: | PF01591 |
---|---|
Interpro abstract (IPR013079): | 6-Phosphofructo-2-kinase ( EC 2.7.1.105 EC 3.1.3.46 ) is a bifunctional enzyme that catalyses both the synthesis and the degradation of fructose-2, 6-bisphosphate. The fructose-2,6-bisphosphatase reaction involves a phosphohistidine intermediate. The catalytic pathway is: This domain forms the N-terminal region of this enzyme, while IPR013078 forms the C-terminal domain. |
GO process: | fructose metabolic process (GO:0006000) |
GO function: | ATP binding (GO:0005524), 6-phosphofructo-2-kinase activity (GO:0003873) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 6PF2K