The domain within your query sequence starts at position 7 and ends at position 198; the E-value for the 6PF2K domain shown below is 1.5e-91.

KRAASIPQFTNSPTMVIMVGLPARGKTYISTKLTRYLNWIGTPTKVFNLGQYRREAVSYR
NYEFFRPDNMEAQLIRKQCALAALKDVHKYLSREEGHVAVFDATNTTRERRSLILQFAKE
HGYKVFFIESICNDPDIIAENIKQVKLGSPDYIDCDQEKVLEDFLKRIECYEINYQPLDE
ELDSHLSYIKIF

6PF2K

 6PF2K
PFAM accession number:PF01591
Interpro abstract (IPR013079):

6-Phosphofructo-2-kinase ( EC 2.7.1.105 EC 3.1.3.46 ) is a bifunctional enzyme that catalyses both the synthesis and the degradation of fructose-2, 6-bisphosphate. The fructose-2,6-bisphosphatase reaction involves a phosphohistidine intermediate. The catalytic pathway is: ATP + D-fructose 6-phosphate = ADP + D-fructose 2,6-bisphosphate D-fructose 2,6-bisphosphate + H 2 O = 6-fructose 6-phosphate + P i The enzyme is important in the regulation of hepatic carbohydrate metabolism and is found in greatest quantities in the liver, kidney and heart. In mammals, several genes often encode different isoforms, each of which differs in its tissue distribution and enzymatic activity [ (PUBMED:9652401) ]. The family described here bears a resemblance to the ATP-driven phospho-fructokinases, however, they share little sequence similarity, although a few residues seem key to their interaction with fructose 6-phosphate [ (PUBMED:9753654) ].

This domain forms the N-terminal region of this enzyme, while IPR013078 forms the C-terminal domain.

GO process:fructose metabolic process (GO:0006000)
GO function:ATP binding (GO:0005524), 6-phosphofructo-2-kinase activity (GO:0003873)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 6PF2K