SMART: Pfam domain 7TM_GPCR

The domain within your query sequence starts at position 38 and ends at position 308; the E-value for the 7TM_GPCR_Srsx domain shown below is 8.2e-8.

FFMAFIGNSIMVILIYLDAHLHTPMYILLSQLSLMDLMLICTTVPQMAFNFLSGNKSISM
VGCGIQIFFYVSLLGAECFLLAAMAYDRYVAICYPLRYPILMSDKICGLMAASSWVLGSL
DGIIEVAAALSFSYCGAREIPHFFCDVPALLTLSCSNTLIFERIIFFCCVIMLTLPVAII
IASYTRVILTVLHMSSAESRHKAFATCSSHLMVVGMYYGAAMFIYMRPSSGRSPTQDKIV
SAFYTILTPMLNPLIYSLRNKEVARAFMKVL

7TM_GPCR_Srsx

PFAM accession number:	PF10320
Interpro abstract (IPR019424):	Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [ (PUBMED:7585938) ]. Srsx is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' [ (PUBMED:18050473) ].

PFAM accession number:

PF10320

Interpro abstract (IPR019424):

Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type [ (PUBMED:7585938) ]. Srsx is a solo family amongst the superfamilies of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' [ (PUBMED:18050473) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry 7TM_GPCR_Srsx