The domain within your query sequence starts at position 11 and ends at position 182; the E-value for the 7TM_GPCR_Srw domain shown below is 5.4e-9.
AIMGVVFTWIMALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHF TIPMIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIFFLICWLPYASVA FYIFTHQGSNFGPIFMTLPAFFAKSSSIYNPVIYIMLNKQFRNCMLTTLCCG
7TM_GPCR_Srw |
![]() |
---|
PFAM accession number: | PF10324 |
---|---|
Interpro abstract (IPR019427): | This entry represents serpentine receptor class w (Srw), which is a solo family amongst the superfamilies of chemoreceptors. The genes encoding Srw do not appear to be under as strong an adaptive evolutionary pressure as those of Srz [ (PUBMED:15761060) ]. |
GO function: | G protein-coupled peptide receptor activity (GO:0008528) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry 7TM_GPCR_Srw