The domain within your query sequence starts at position 19 and ends at position 79; the E-value for the AAA_31 domain shown below is 1.5e-8.
HIILVLSGKGGVGKSTISTELALALRHQGKKVGILDVDLCGPSIPHMLRAQGKAVHQCDN G
AAA_31 |
---|
PFAM accession number: | PF13614 |
---|---|
Interpro abstract (IPR025669): | This entry represents a wide variety of AAA domains, including some that have lost essential nucleotide binding residues in the P-loop. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_31