The domain within your query sequence starts at position 413 and ends at position 506; the E-value for the AAA_assoc_2 domain shown below is 6.4e-26.
SEPSVFIEDKAVDTLAYLSDGDARTGLNGLQLAVLARLSSRKVFCKKSGQTYSPSRVLIT ENDVKEGLQRSHILYDRAGEEHYNCISALHKAMR
AAA_assoc_2 |
 |
|---|
| PFAM accession number: | PF16193 |
|---|---|
| Interpro abstract (IPR032423): | This domain is C-terminal to the AAA domains and is found in a subset of AAA ATPase proteins ranging from archaeal to fungi, plants and mammals. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAA_assoc_2