The domain within your query sequence starts at position 6 and ends at position 124; the E-value for the AAR2 domain shown below is 3.2e-34.

MDPELAKQLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLYYSSVDK
ANPREVGPRMGFFLSLKQRGLTVLRWNAVQEEVDLSPAPEAEVEAMRANLPDLDQFLGP

AAR2

AAR2
PFAM accession number:PF05282
Interpro abstract (IPR007946):

This family consists of several eukaryotic AAR2-like proteins. The Saccharomyces cerevisiae protein AAR2 is involved in splicing pre-mRNA of the a1 cistron and other genes that are important for cell growth [ (PUBMED:1922071) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AAR2