The domain within your query sequence starts at position 82 and ends at position 504; the E-value for the AA_permease_2 domain shown below is 2.9e-47.
LTTLDLVSLGVGSTLGAGVYVLAGEVAREKAGPSIIICFLIAALSSVMSGLCYAEFGARV PCSGSAYLYSYVTVGQLLAFITGWNLILNYVIGAASVARAWSAAFDGLIGNHISQAMQTT FPIQVPSFLAKYPDFFALGLVIVLTGILALGARESALVTRVFTGVNLLVLCFVSLSGLIN GKLHNWQLTEDDYKLALLESNNTDSLGPMGSGGFMPFGLKGILRGTATCFFAFIGFDCIA STGEEARCPQRSIPLGIVTSLFICFLMYFGVSGALTLMIPYYQININSPLPQAFIHVGWG PARYAVAVGTLCALSSSLIGSIFPVPRVVYSMAEDGLLFRKLAYVHPRTHTPVLATVLCG IIAAFMAFLVELSDLVDLSSIGTLLAYTLVTFSVLILRYQPDQVLSSCKREKSESAAVEL EPG
AA_permease_2 |
![]() |
---|
PFAM accession number: | PF13520 |
---|---|
Interpro abstract (IPR002293): | Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell. A number of such proteins have been found to be evolutionary related [ (PUBMED:3146645) (PUBMED:2687114) (PUBMED:8382989) ]. These proteins include several yeast specific and general amino acid permeases; Emericella nidulans (Aspergillus nidulans) proline transport protein (gene prnB); Trichoderma harzianum amino acid permease INDA1; Salmonella typhimurium L-asparagine permease (gene ansP); and several Escherichia coli and other bacterial permeases and transport proteins. These proteins seem to contain up to 12 transmembrane segments. This entry consists of members of the amino acid-polyamine-organocation (APC) superfamily [ (PUBMED:10931886) ]. Also included in this entry is the methylthioribose transporter mtrA from Bacillus subtilis, which transports methylthioribose into the cell [ (PUBMED:29280348) ]. |
GO process: | transmembrane transport (GO:0055085) |
GO component: | membrane (GO:0016020) |
GO function: | transmembrane transporter activity (GO:0022857) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AA_permease_2