The domain within your query sequence starts at position 276 and ends at position 446; the E-value for the ABA_GPCR domain shown below is 4.9e-46.

EYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVLDRVGKTDPVTRGIEITVNYLGIQFD
VKFWSQHISFILVGIIIVTSIRGLLITLTKFFYAISSSKSSNVIVLLLAQIMGMYFVSSV
LLIRMSMPPEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHK

ABA_GPCR

• PFAM accession number: PF12430
• Interpro abstract (IPR025969):

  This domain is found in eukaryotes, and is typically between 177 and 216 amino acids in length. It is found in the abscisic acid (ABA) G-protein coupled receptor [ (PUBMED:19135895) ]. ABA is a stress hormone in plants. It is also found proteins identified as Golgi pH regulators [ (PUBMED:18794847) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABA_GPCR