The domain within your query sequence starts at position 276 and ends at position 446; the E-value for the ABA_GPCR domain shown below is 4.9e-46.
EYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIVLDRVGKTDPVTRGIEITVNYLGIQFD VKFWSQHISFILVGIIIVTSIRGLLITLTKFFYAISSSKSSNVIVLLLAQIMGMYFVSSV LLIRMSMPPEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHK
ABA_GPCR |
![]() |
---|
PFAM accession number: | PF12430 |
---|---|
Interpro abstract (IPR025969): | This domain is found in eukaryotes, and is typically between 177 and 216 amino acids in length. It is found in the abscisic acid (ABA) G-protein coupled receptor [ (PUBMED:19135895) ]. ABA is a stress hormone in plants. It is also found proteins identified as Golgi pH regulators [ (PUBMED:18794847) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ABA_GPCR