The domain within your query sequence starts at position 6 and ends at position 70; the E-value for the ACTL7A_N domain shown below is 1.3e-39.
VWAPQTANIGDGPAKKASDQASMQTQVLQTASLKDGPAKRAVWVRRDNAETEDPVKSTMS KDRPR
ACTL7A_N |
---|
PFAM accession number: | PF16840 |
---|---|
Interpro abstract (IPR031769): | This entry represents the N terminus of actin-like protein 7A. This domain interacts and forms a heterodimer with TES, a putative human tumor suppressor. This heterodimer then interacts with ENAH to form a heterotrimer [ (PUBMED:21278383) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACTL7A_N