The domain within your query sequence starts at position 71 and ends at position 138; the E-value for the ACT_7 domain shown below is 1.3e-19.
VAEATWLVMNVSHSGSVVQAAGVTKIARSVIAPLAEHHVSVLMLSTYQTDFILVREQDLS VVIHTLAQ
ACT_7 |
![]() |
---|
PFAM accession number: | PF13840 |
---|---|
Interpro abstract (IPR027795): | The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements [ (PUBMED:16987805) ]. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding [ (PUBMED:18368466) ]. This ACT domain is found in CASTOR proteins IPR026249 and C-terminal in some aspartate kinases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ACT_7