SMART: Pfam domain AIMP2_LysRS

The domain within your query sequence starts at position 1 and ends at position 44; the E-value for the AIMP2_LysRS_bd domain shown below is 8.3e-26.

MPMYQVKPYHGGSAPLHVELPTCMYRLPNVHSKTTSPATDAGHV

AIMP2_LysRS_bd

PFAM accession number:	PF16780
Interpro abstract (IPR031889):	This entry represents the lysyl-tRNA synthetase (LysRS) binding domain of AIMP2 (aminoacyl tRNA synthase complex-interacting multifunctional protein 2). LysRS can serve as a transcription regulator that can be released from the cytoplasmic multi-tRNA synthetase complex (MSC) to activate the transcription factor MITF in stimulated mast cells. In quiescent cells, LysRS is held in the MSC via its interactions with AIMP2 [ (PUBMED:23159739) ].

PFAM accession number:

PF16780

Interpro abstract (IPR031889):

This entry represents the lysyl-tRNA synthetase (LysRS) binding domain of AIMP2 (aminoacyl tRNA synthase complex-interacting multifunctional protein 2). LysRS can serve as a transcription regulator that can be released from the cytoplasmic multi-tRNA synthetase complex (MSC) to activate the transcription factor MITF in stimulated mast cells. In quiescent cells, LysRS is held in the MSC via its interactions with AIMP2 [ (PUBMED:23159739) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AIMP2_LysRS_bd