SMART: Pfam domain AIP3

The domain within your query sequence starts at position 218 and ends at position 330; the E-value for the AIP3 domain shown below is 2e-11.

FLQFGEETRRVHITHEVSSLDTLHALIAHMFPQKLTMGMLKSPNTAILIKDEARNVFYEL
EDVRDIQDRSIIKIYRKEPLYAAFPGSHLTNGDLRREMVYASRESSPTRRLNN

AIP3

PFAM accession number:	PF03915
Interpro abstract (IPR022782):	This entry represents the C-terminal domain of actin interacting protein 3 (also known as Bud6 in budding yeasts). Bud6 is an actin- and formin-interacting protein. The N-terminal half of Bud6 is a microtubule binding domain required for its localisation and for its function in cortical capture of astral microtubule ends. The C-terminal half (residues 489-788) directly facilitates actin filament assembly by the formin Bni1 and is required for NPF (nucleation-promoting factor) activity. The domain represented in this entry (residues 365-776) is overlapped with the C-terminal half of Bud6 in this study [ (PUBMED:23161908) ]. This entry also includes proteins from animals.

PFAM accession number:

PF03915

Interpro abstract (IPR022782):

This entry represents the C-terminal domain of actin interacting protein 3 (also known as Bud6 in budding yeasts). Bud6 is an actin- and formin-interacting protein. The N-terminal half of Bud6 is a microtubule binding domain required for its localisation and for its function in cortical capture of astral microtubule ends. The C-terminal half (residues 489-788) directly facilitates actin filament assembly by the formin Bni1 and is required for NPF (nucleation-promoting factor) activity. The domain represented in this entry (residues 365-776) is overlapped with the C-terminal half of Bud6 in this study [ (PUBMED:23161908) ]. This entry also includes proteins from animals.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry AIP3