The domain within your query sequence starts at position 3125 and ends at position 3247; the E-value for the ALMS_motif domain shown below is 1.8e-42.
FVRATLQESLQLHRPDFISHSGERIKRLKLLVQERKLQSLFQSEREALFHSARPLPRRVL LAVQKNKPIGKKEMIQRTRRIYEQLPEVKKKREEEKRKSEYKSYWLRAQHYKMKVTNHLL GRK
ALMS_motif |
![]() |
---|
PFAM accession number: | PF15309 |
---|---|
Interpro abstract (IPR029299): | This domain is found at the C terminus of Alstrom syndrome protein 1 (ALMS1), KIAA1731 and C10orf90 [ (PUBMED:11941369) (PUBMED:20844083) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ALMS_motif