The domain within your query sequence starts at position 520 and ends at position 595; the E-value for the AMP-binding_C domain shown below is 2.3e-10.
EVEGTLSRLLHMADVAVYGVEVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLYARP IFLRFLPELHKTGTFK
AMP-binding_C |
 |
|---|
| PFAM accession number: | PF13193 |
|---|---|
| Interpro abstract (IPR025110): | This is a small domain that is found C-terminal to IPR000873 . It has a central beta sheet core that is flanked by alpha helices. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry AMP-binding_C