The domain within your query sequence starts at position 1 and ends at position 80; the E-value for the ANAPC_CDC26 domain shown below is 7.8e-14.
MLRRKPTRLELKLDDIEEFESIRKDLEARKKQKEDVEGVGTSDGEGAAGLSSDPKSREQM INDRIGYKPQLKSNNRTSQF
ANAPC_CDC26 |
---|
PFAM accession number: | PF10471 |
---|---|
Interpro abstract (IPR018860): | The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis, such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome. This entry represents subunit CDC26, whose exact function is not known [ (PUBMED:10922056) ]. |
GO process: | anaphase-promoting complex-dependent catabolic process (GO:0031145), regulation of mitotic metaphase/anaphase transition (GO:0030071) |
GO component: | anaphase-promoting complex (GO:0005680) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ANAPC_CDC26