The domain within your query sequence starts at position 8 and ends at position 122; the E-value for the ARL2_Bind_BART domain shown below is 3.8e-43.

EVEWVVESIAGFLRGPDWSIPILDFVEQKCEVFDDEEESKLTYTEIHQEYKELVEKLLES
YLKEIGINEDQFQEACTSPLAKTRTSQAILQPVLAAEDFTIFKAMMVQKNIEMQL

ARL2_Bind_BART

ARL2_Bind_BART
PFAM accession number:PF11527
Interpro abstract (IPR023379):

This domain is found in ADP-ribosylation factor-like 2 (ARF2) binding protein, also known as BART. BART binds specifically to ARF2.GTP with a high affinity. However, it does not bind to ARF2.GDP. It is thought that this specific interaction is due to BART being the first identified ARF2-specific effector. The function is not completely characterised [ (PUBMED:10488091) ]. BART is predominantly cytosolic but can also be found to be associated with mitochondria. BART is also involved in binding to the adenine nucleotide transporter ANT1 [ (PUBMED:11809823) ].

The interactions between ARL2 and BART involve a conserved N-terminal LLxIL motif of ARL2 [ (PUBMED:19368893) ]. This domain is also found in CFAP36/CCDC104, a protein renamed as BARTL1. The BART-like domain of CCDC104/BARTL1 recognizes an LLxILxxL motif at the N-terminal amphipathic helix of ARL3 [ (PUBMED:26455799) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ARL2_Bind_BART