SMART: Pfam domain ASH

The domain within your query sequence starts at position 559 and ends at position 659; the E-value for the ASH domain shown below is 9.4e-17.

KEGIIEPSGVQAVQISFSSTILGYFEEEFLIDVNGSPEPVKMTIRGCVIGPTFHFNVPAL
NFGNVSYGFPHTLMCSLNNTSLVPMTFKLRVRGDGEGMSSI

ASH

PFAM accession number:	PF15780
Interpro abstract (IPR031549):	The ASH (ASPM-SPD-2-Hydin) domain or N-terminal domain of abnormal spindle-like microcephaly-associated protein (ASPM) is found in proteins associated with cilia, flagella, the centrosome and the Golgi complex [ (PUBMED:25018876) (PUBMED:15068791) ]. The domain is also found in Hydin and OCRL whose deficiencies are associated with hydrocephalus and Lowe oculocerebrorenal syndrome (OCRL), respectively. The presence of ASH in centrosomal and ciliary proteins indicates that ASPM may possess roles not only in mitotic spindle regulation, but also in ciliary and flagellar function [ (PUBMED:16443634) ].

PFAM accession number:

PF15780

Interpro abstract (IPR031549):

The ASH (ASPM-SPD-2-Hydin) domain or N-terminal domain of abnormal spindle-like microcephaly-associated protein (ASPM) is found in proteins associated with cilia, flagella, the centrosome and the Golgi complex [ (PUBMED:25018876) (PUBMED:15068791) ]. The domain is also found in Hydin and OCRL whose deficiencies are associated with hydrocephalus and Lowe oculocerebrorenal syndrome (OCRL), respectively. The presence of ASH in centrosomal and ciliary proteins indicates that ASPM may possess roles not only in mitotic spindle regulation, but also in ciliary and flagellar function [ (PUBMED:16443634) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ASH