The domain within your query sequence starts at position 171 and ends at position 238; the E-value for the ASL_C2 domain shown below is 1.4e-21.

MLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNLLSLQELQTISPLFSGDVSHV
WDYSHSVE

ASL_C2

ASL_C2
PFAM accession number:PF14698
Interpro abstract (IPR029419):

This domain is found at the C terminus of argininosuccinate lyase [ (PUBMED:11698398) (PUBMED:9256435) ].

Argininosuccinate lyase (ASL, EC 4.3.2.1 ) participates in arginine synthesis in all organisms catalysing the reversible breakdown of argininosuccinate to arginine and fumarate. The reaction is also part of the urea cycle [ (PUBMED:15502303) ]. The crystal structures of ASLs from several species have been studied, in particular the duck delta1 and delta2 eye lens crystallins, which are inactive and active homologues of ASL, respectively [ (PUBMED:11698398) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ASL_C2