The domain within your query sequence starts at position 1327 and ends at position 1463; the E-value for the ATG11 domain shown below is 6.7e-28.

SEEKQRIMLLERTLQLKEEENKRLNQRLMSQSLSSVSSRHSEKIAIRDFQVGDLVLIILD
ERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQN
RFKVPLGTKFYRVKAVS

ATG11

• PFAM accession number: PF10377
• Interpro abstract (IPR019460):

  This entry represents a domain found in C terminus of Atg11. Proteins containing this domain include Taf1 and Atg11. In Schizosaccharomyces pombe (fission yeast) Taf1 (taz1 interacting factor) is part of the telomere cap complex. In Saccharomyces cerevisiae (baker's yeast) Atg11 is known to be involved in vacuolar targeting and peroxisome degradation [ (PUBMED:11309418) (PUBMED:15659643) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATG11