The domain within your query sequence starts at position 166 and ends at position 253; the E-value for the ATP-grasp domain shown below is 8.3e-8.
MAAAGVPVVEGYHGKDQSDQCLREHAGKIGYPVMIKAVRGGGGKGMRIVRSEREFQEQLE SARREAKKSFNDDAMLIEKFVDTPRSTA
ATP-grasp |
![]() |
---|
PFAM accession number: | PF02222 |
---|---|
Interpro abstract (IPR003135): | The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis. This family does not contain all known ATP-grasp domain members. All the enzymes of this family possess ATP-dependent carboxylate-amine ligase activity, and their catalytic mechanisms are likely to include acylphosphate intermediates. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP-grasp