The domain within your query sequence starts at position 55 and ends at position 134; the E-value for the ATP-gua_PtransN domain shown below is 3.3e-38.

PDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEE
TYEVFAELFDPVIQERHNGY

ATP-gua_PtransN

ATP-gua_PtransN
PFAM accession number:PF02807
Interpro abstract (IPR022413):

ATP:guanido phosphotransferases are a family of structurally and functionally related enzymes [ (PUBMED:2324092) (PUBMED:7819288) ] that reversibly catalyse the transfer of phosphate between ATP and various phosphogens. The enzymes belonging to this family include:

  • Glycocyamine kinase ( EC 2.7.3.1 ), which catalyses the transfer of phosphate from ATP to guanidoacetate.
  • Arginine kinase ( EC 2.7.3.3 ), which catalyses the transfer of phosphate from ATP to arginine.
  • Taurocyamine kinase ( EC 2.7.3.4 ), an annelid-specific enzyme that catalyses the transfer of phosphate from ATP to taurocyamine.
  • Lombricine kinase ( EC 2.7.3.5 ), an annelid-specific enzyme that catalyses the transfer of phosphate from ATP to lombricine.
  • Smc74, a cercaria-specific enzyme from Schistosoma mansoni [ (PUBMED:2324092) ].
  • Creatine kinase ( EC 2.7.3.2 ) (CK) [ (PUBMED:3896131) (PUBMED:2324105) ], which catalyses the reversible transfer of high energy phosphate from ATP to creatine, generating phosphocreatine and ADP.

Creatine kinase plays an important role in energy metabolism of vertebrates. There are at least four different, but very closely related, forms of CK. Two isozymes, M (muscle) and B (brain), are cytosolic, while the other two are mitochondrial. In sea urchins there is a flagellar isozyme, which consists of the triplication of a CK-domain. A cysteine residue is implicated in the catalytic activity of these enzymes and the region around this active site residue is highly conserved.

This entry represents the N-terminal domain of ATP:guanido phosphotransferase, which has an all-alpha fold consisting of an irregular array of 6 short helices [ (PUBMED:8692275) ].

GO function:transferase activity, transferring phosphorus-containing groups (GO:0016772), kinase activity (GO:0016301)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP-gua_PtransN