The domain within your query sequence starts at position 55 and ends at position 134; the E-value for the ATP-gua_PtransN domain shown below is 3.3e-38.
PDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEE TYEVFAELFDPVIQERHNGY
ATP-gua_PtransN |
---|
PFAM accession number: | PF02807 |
---|---|
Interpro abstract (IPR022413): | ATP:guanido phosphotransferases are a family of structurally and functionally related enzymes [ (PUBMED:2324092) (PUBMED:7819288) ] that reversibly catalyse the transfer of phosphate between ATP and various phosphogens. The enzymes belonging to this family include:
Creatine kinase plays an important role in energy metabolism of vertebrates. There are at least four different, but very closely related, forms of CK. Two isozymes, M (muscle) and B (brain), are cytosolic, while the other two are mitochondrial. In sea urchins there is a flagellar isozyme, which consists of the triplication of a CK-domain. A cysteine residue is implicated in the catalytic activity of these enzymes and the region around this active site residue is highly conserved. This entry represents the N-terminal domain of ATP:guanido phosphotransferase, which has an all-alpha fold consisting of an irregular array of 6 short helices [ (PUBMED:8692275) ]. |
GO function: | transferase activity, transferring phosphorus-containing groups (GO:0016772), kinase activity (GO:0016301) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry ATP-gua_PtransN